![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.77: RL5-like [55281] (1 superfamily) beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654 |
![]() | Superfamily d.77.1: RL5-like [55282] (3 families) ![]() |
![]() | Family d.77.1.2: SSO1042-like [160489] (5 proteins) Pfam PF01877; DUF54 |
![]() | Protein Hypothetical protein AF2318 [160492] (1 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [160493] (1 PDB entry) Uniprot O27966 3-143 |
![]() | Domain d2ogkc_: 2ogk C: [148769] automated match to d2ogka1 |
PDB Entry: 2ogk (more details), 3 Å
SCOPe Domain Sequences for d2ogkc_:
Sequence, based on SEQRES records: (download)
>d2ogkc_ d.77.1.2 (C:) Hypothetical protein AF2318 {Archaeoglobus fulgidus [TaxId: 2234]} gkiewvrvsavvhstedrekvgeaistlfpfefeiavskakghygnpmeyleveltksse ikkfwknllellgeqaeeilstledrideqnvlhiridkqkaylgevsltsggdpiavkl rlvtypskrekviefarelc
>d2ogkc_ d.77.1.2 (C:) Hypothetical protein AF2318 {Archaeoglobus fulgidus [TaxId: 2234]} gkiewvrvsavvhstedrekvgeaistlfpfefeiavsmeyleveltksseikkfwknll ellgeqaeeilstledrideqnvlhiridkqkaylgevsltsggdpiavklrlvtypskr ekviefarelc
Timeline for d2ogkc_: