SCOPe 2.04: Domain d2ogkd_: 2ogk D:

Lineage for d2ogkd_ (2ogk D:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.77: RL5-like [55281] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654

4. Superfamily d.77.1: RL5-like [55282] (3 families)

5. Family d.77.1.2: SSO1042-like [160489] (5 proteins)
   Pfam PF01877; DUF54

6. Protein Hypothetical protein AF2318 [160492] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [160493] (1 PDB entry)
   Uniprot O27966 3-143

8. Domain d2ogkd_: 2ogk D: [148770]
   automated match to d2ogka1

Details for d2ogkd_

PDB Entry: 2ogk, 3 Å

PDB Description: crystal structure of protein af2318 from archaeglobus fulgidus, pfam duf54

PDB Compounds: (D:) hypothetical protein

SCOPe Domain Sequences for d2ogkd_:

Sequence; same for both SEQRES and ATOM records:

>d2ogkd_ d.77.1.2 (D:) Hypothetical protein AF2318 {Archaeoglobus fulgidus [TaxId: 2234]}
kgkiewvrvsavvhstedrekvgeaistlfpfefeiavskakghygnpmeyleveltkss
eikkfwknllellgeqaeeilstledrideqnvlhiridkqkaylgevsltsggdpiavk
lrlvtypskrekviefarelct

Timeline for d2ogkd_:

• d2ogkd_ first appeared in SCOP 1.75, called d2ogkd1
  
• d2ogkd_ was called d2ogkd1 in SCOPe 2.03
  
• d2ogkd_ appears in SCOPe 2.05
  
• d2ogkd_ appears in the current release, SCOPe 2.08