Class b: All beta proteins [48724] (177 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.5: Third domain of FERM [50776] (8 proteins) |
Protein Radixin [50779] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [50780] (9 PDB entries) |
Domain d2emta2: 2emt A:199-297 [146929] Other proteins in same PDB: d2emta1, d2emta3, d2emta4, d2emtb1, d2emtb3, d2emtb4 automatically matched to d1gc6a2 |
PDB Entry: 2emt (more details), 2.8 Å
SCOPe Domain Sequences for d2emta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2emta2 b.55.1.5 (A:199-297) Radixin {Mouse (Mus musculus) [TaxId: 10090]} emygvnyfeiknkkgtelwlgvdalglniyehddkltpkigfpwseirnisfndkkfvik pidkkapdfvfyaprlrinkrilalcmgnhelymrrrkp
Timeline for d2emta2:
View in 3D Domains from other chains: (mouse over for more information) d2emtb1, d2emtb2, d2emtb3, d2emtb4 |