Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.4: First domain of FERM [54256] (6 proteins) |
Protein Radixin [54259] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [54260] (9 PDB entries) |
Domain d2emta3: 2emt A:2-87 [146930] Other proteins in same PDB: d2emta1, d2emta2, d2emta4, d2emtb1, d2emtb2, d2emtb4 automatically matched to d1gc6a3 |
PDB Entry: 2emt (more details), 2.8 Å
SCOPe Domain Sequences for d2emta3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2emta3 d.15.1.4 (A:2-87) Radixin {Mouse (Mus musculus) [TaxId: 10090]} pkpinvrvttmdaelefaiqpnttgkqlfdqvvktvglrevwffglqyvdskgystwlkl nkkvtqqdvkkenplqfkfrakffpe
Timeline for d2emta3:
View in 3D Domains from other chains: (mouse over for more information) d2emtb1, d2emtb2, d2emtb3, d2emtb4 |