Lineage for d2emtb1 (2emt B:88-198)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986709Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1986752Superfamily a.11.2: Second domain of FERM [47031] (2 families) (S)
    automatically mapped to Pfam PF00373
  5. 1986753Family a.11.2.1: Second domain of FERM [47032] (9 proteins)
  6. 1986783Protein Radixin [47035] (1 species)
  7. 1986784Species Mouse (Mus musculus) [TaxId:10090] [47036] (9 PDB entries)
  8. 1986798Domain d2emtb1: 2emt B:88-198 [146931]
    Other proteins in same PDB: d2emta2, d2emta3, d2emta4, d2emtb2, d2emtb3, d2emtb4
    automatically matched to d1gc6a1

Details for d2emtb1

PDB Entry: 2emt (more details), 2.8 Å

PDB Description: crystal structure analysis of the radixin ferm domain complexed with adhesion molecule psgl-1
PDB Compounds: (B:) Radixin

SCOPe Domain Sequences for d2emtb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2emtb1 a.11.2.1 (B:88-198) Radixin {Mouse (Mus musculus) [TaxId: 10090]}
dvseeliqeitqrlfflqvkeailndeiycppetavllasyavqakygdynkeihkpgyl
andrllpqrvleqhkltkeqweeriqnwheehrgmlredsmmeylkiaqdl

SCOPe Domain Coordinates for d2emtb1:

Click to download the PDB-style file with coordinates for d2emtb1.
(The format of our PDB-style files is described here.)

Timeline for d2emtb1: