| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
| Family d.14.1.1: Translational machinery components [54212] (5 proteins) |
| Protein Elongation factor G (EF-G), domain IV [54213] (2 species) |
| Species Thermus thermophilus, EF-G-2 [TaxId:274] [142925] (2 PDB entries) Uniprot Q5SI76 448-562 TTHA1498 |
| Domain d2dy1a3: 2dy1 A:455-569 [146609] Other proteins in same PDB: d2dy1a1, d2dy1a2, d2dy1a4, d2dy1a5, d2dy1a6 automated match to d1wdta3 complexed with gtp, mg |
PDB Entry: 2dy1 (more details), 1.6 Å
SCOPe Domain Sequences for d2dy1a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dy1a3 d.14.1.1 (A:455-569) Elongation factor G (EF-G), domain IV {Thermus thermophilus, EF-G-2 [TaxId: 274]}
pyretikkvaegqgkykkqtgghgqygdvwlrlepaseygfewritggvipskyqeaiee
gikeaakkgvlagfpvmgfkaivyngsyhevdssdlafqiaaslafkkvmaeahp
Timeline for d2dy1a3: