PDB entry 2dy1

View 2dy1 on RCSB PDB site
Description: Crystal structure of EF-G-2 from Thermus thermophilus
Class: signaling protein, translation
Keywords: Translocation, ELONGATION, GTP Complex, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN, TRANSLATION
Deposited on 2006-09-04, released 2007-09-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.188
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dy1A (A:)
    mgteggamirtvalvghagsgkttlteallyktgakerrgrveegttttdytpeaklhrt
    tvrtgvapllfrghrvflldapgygdfvgeirgaleaadaalvavsaeagvqvgterawt
    vaerlglprmvvvtkldkggdyyalledlrstlgpilpidlplyeggkwvglidvfhgka
    yryengeereaevppeerervqrfrqevleaivetdegllekylegeevtgealekafhe
    avrrgllypvalasgereigvlpllelilealpspterfgdgpplakvfkvqvdpfmgqv
    aylrlyrgrlkpgdslqseagqvrlphlyvpmgkdlleveeaeagfvlgvpkaeglhrgm
    vlwqgekpeseevpfarlpdpnvpvalhpkgrtdearlgealrklleedpslklerqeet
    gelllwghgelhlatakerlqdygvevefsvpkvpyretikkvaegqgkykkqtgghgqy
    gdvwlrlepaseygfewritggvipskyqeaieegikeaakkgvlagfpvmgfkaivyng
    syhevdssdlafqiaaslafkkvmaeahpvllepiyrlkvlapqervgdvlsdlqarrgr
    ilgmeqegalsvvhaevplaevleyykalpgltggagaytlefshyaevpphlaqrivqe
    raqeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dy1A (A:)
    gamirtvalvghagsgkttlteallyktgakerrgrveegttttdytpeaklhrttvrtg
    vapllfrghrvflldapgygdfvgeirgaleaadaalvavsaeagvqvgterawtvaerl
    glprmvvvtkldkggdyyalledlrstlgpilpidlplyeggkwvglidvfhgkayryen
    geereaevppeerervqrfrqevleaivetdegllekylegeevtgealekafheavrrg
    llypvalasgereigvlpllelilealpspterfgdgpplakvfkvqvdpfmgqvaylrl
    yrgrlkpgdslqseagqvrlphlyvpmgkdlleveeaeagfvlgvpkaeglhrgmvlwqg
    ekpeseevpfarlpdpnvpvalhpkgrtdearlgealrklleedpslklerqeetgelll
    wghgelhlatakerlqdygvevefsvpkvpyretikkvaegqgkykkqtgghgqygdvwl
    rlepaseygfewritggvipskyqeaieegikeaakkgvlagfpvmgfkaivyngsyhev
    dssdlafqiaaslafkkvmaeahpvllepiyrlkvlapqervgdvlsdlqarrgrilgme
    qegalsvvhaevplaevleyykalpgltggagaytlefshyaevpphlaqrivqeraqeg