Class b: All beta proteins [48724] (180 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.1: Elongation factors [50448] (11 proteins) |
Protein Elongation factor G (EF-G), domain II [50456] (2 species) |
Species Thermus thermophilus, EF-G-2 [TaxId:274] [141334] (2 PDB entries) Uniprot Q5SI76 268-370 TTHA1498 |
Domain d2dy1a1: 2dy1 A:275-377 [146607] Other proteins in same PDB: d2dy1a2, d2dy1a3, d2dy1a4, d2dy1a5, d2dy1a6 automated match to d1wdta1 complexed with gtp, mg |
PDB Entry: 2dy1 (more details), 1.6 Å
SCOPe Domain Sequences for d2dy1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dy1a1 b.43.3.1 (A:275-377) Elongation factor G (EF-G), domain II {Thermus thermophilus, EF-G-2 [TaxId: 274]} pterfgdgpplakvfkvqvdpfmgqvaylrlyrgrlkpgdslqseagqvrlphlyvpmgk dlleveeaeagfvlgvpkaeglhrgmvlwqgekpeseevpfar
Timeline for d2dy1a1: