Lineage for d2bkhb_ (2bkh B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2710608Protein Calmodulin [47516] (13 species)
  7. 2710683Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [47522] (13 PDB entries)
  8. 2710689Domain d2bkhb_: 2bkh B: [146152]
    automated match to d2bbma_
    complexed with ca, gol

Details for d2bkhb_

PDB Entry: 2bkh (more details), 2.4 Å

PDB Description: myosin vi nucleotide-free (mdinsert2) crystal structure
PDB Compounds: (B:) calmodulin

SCOPe Domain Sequences for d2bkhb_:

Sequence, based on SEQRES records: (download)

>d2bkhb_ a.39.1.5 (B:) Calmodulin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
idfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeevd
emireadidgdgqvnyeefvtmmts

Sequence, based on observed residues (ATOM records): (download)

>d2bkhb_ a.39.1.5 (B:) Calmodulin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
idfpefltmmseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeevdemireadi
dgdgqvnyeefvtmmts

SCOPe Domain Coordinates for d2bkhb_:

Click to download the PDB-style file with coordinates for d2bkhb_.
(The format of our PDB-style files is described here.)

Timeline for d2bkhb_: