PDB entry 2bkh

View 2bkh on RCSB PDB site
Description: myosin vi nucleotide-free (mdinsert2) crystal structure
Class: motor protein/metal-binding protein
Keywords: motor protein/metal-binding protein, complex (motor protein/calmodulin), myosin vi, reverse myosin, calmodulin, non-conventional myosin, nucleotide-free conformation, muscle protein
Deposited on 2005-02-16, released 2005-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.208
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: unconventional myosin
    Species: SUS SCROFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q29122 (376-End)
      • conflict see remark 9 (545)
      • conflict see remark 9 (570-571)
      • conflict see remark 9 (712)
      • conflict see remark 9 (719-720)
  • Chain 'B':
    Compound: calmodulin
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BKH
    • Uniprot P62152 (Start-147)
    Domains in SCOPe 2.07: d2bkhb_
  • Heterogens: GOL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bkhB (B:)
    madqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadg
    ngtidfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltde
    evdemireadidgdgqvnyeefvtmmtsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkhB (B:)
    qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
    idfpefltmmseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeevdemireadi
    dgdgqvnyeefvtmmts