Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (27 PDB entries) |
Domain d2icwj1: 2icw J:1-113 [145521] Other proteins in same PDB: d2icwa1, d2icwa2, d2icwb1, d2icwb2, d2icwd1, d2icwd2, d2icwe1, d2icwe2, d2icwg_, d2icwh_, d2icwl_ |
PDB Entry: 2icw (more details), 2.41 Å
SCOPe Domain Sequences for d2icwj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2icwj1 b.1.1.1 (J:1-113) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} eaavtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghelrlihysygagstekgdi pdgykasrpsqenfslilesatpsqtsvyfcasggggtlyfgagtrlsvlssa
Timeline for d2icwj1: