Lineage for d2icwa2 (2icw A:13-81)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198436Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 1198509Species Mouse (Mus musculus), I-AU [TaxId:10090] [89859] (17 PDB entries)
  8. 1198517Domain d2icwa2: 2icw A:13-81 [137244]
    Other proteins in same PDB: d2icwa1, d2icwb1, d2icwb2, d2icwd1, d2icwe1, d2icwe2, d2icwg_, d2icwh_, d2icwj1, d2icwl_
    automatically matched to d1k2da2

Details for d2icwa2

PDB Entry: 2icw (more details), 2.41 Å

PDB Description: Crystal structure of a complete ternary complex between TCR, superantigen, and peptide-MHC class II molecule
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d2icwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2icwa2 d.19.1.1 (A:13-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]}
ylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalaniavdkanlei
mtkrsnytp

SCOPe Domain Coordinates for d2icwa2:

Click to download the PDB-style file with coordinates for d2icwa2.
(The format of our PDB-style files is described here.)

Timeline for d2icwa2: