PDB entry 2icw

View 2icw on RCSB PDB site
Description: Crystal structure of a complete ternary complex between TCR, superantigen, and peptide-MHC class II molecule
Class: immune system
Keywords: TCR, MHC, superantigen, protein-protein complex, IMMUNE SYSTEM
Deposited on 2006-09-13, released 2007-03-20
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: 0.242
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hla class II histocompatibility antigen, dr alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DRA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01903 (0-178)
      • modified residue (20)
      • modified residue (33)
      • modified residue (70)
    Domains in SCOPe 2.02: d2icwa1, d2icwa2
  • Chain 'B':
    Compound: HLA class II histocompatibility antigen, DRB1-1 beta chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DRB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2icwb1, d2icwb2
  • Chain 'C':
    Compound: haemagglutinin peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2ICW (0-12)
  • Chain 'D':
    Compound: hla class II histocompatibility antigen, dr alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DRA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01903 (0-178)
      • modified residue (20)
      • modified residue (33)
      • modified residue (70)
    Domains in SCOPe 2.02: d2icwd1, d2icwd2
  • Chain 'E':
    Compound: HLA class II histocompatibility antigen, DRB1-1 beta chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DRB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2icwe1, d2icwe2
  • Chain 'F':
    Compound: haemagglutinin peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2ICW (0-12)
  • Chain 'G':
    Compound: Mycoplasma arthritidis mitogen
    Species: Mycoplasma arthritidis [TaxId:2111]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2icwg_
  • Chain 'H':
    Compound: Mycoplasma arthritidis mitogen
    Species: Mycoplasma arthritidis [TaxId:2111]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2icwh_
  • Chain 'I':
    Compound: T-cell receptor alpha chain V
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01738 (0-109)
      • engineered (42)
      • engineered (81)
  • Chain 'J':
    Compound: T-cell receptor beta chain V
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04213 (0-79)
      • see remark 999 (9)
      • engineered (16)
      • see remark 999 (23)
      • see remark 999 (29-30)
      • engineered (41)
      • see remark 999 (50)
      • see remark 999 (52)
      • engineered (79)
      • see remark 999 (80-97)
      • see remark 999 (99-109)
      • cloning artifact (110-112)
    Domains in SCOPe 2.02: d2icwj1
  • Chain 'K':
    Compound: T-cell receptor alpha chain V
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01738 (Start-109)
      • engineered (42)
      • engineered (81)
  • Chain 'L':
    Compound: T-cell receptor beta chain V
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04213 (Start-79)
      • see remark 999 (9)
      • engineered (16)
      • see remark 999 (23)
      • see remark 999 (29-30)
      • engineered (41)
      • see remark 999 (50)
      • see remark 999 (52)
      • engineered (79)
      • see remark 999 (80-97)
      • see remark 999 (99-109)
      • cloning artifact (110-112)
    Domains in SCOPe 2.02: d2icwl_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2icwA (A:)
    eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
    iavdkanleimtkrsnytpitnvppevtvltnspvelrepnvlicfidkftppvvnvtwl
    rngkpvttgvsetvflpredhlfrkfhylpflpstedvydcrvehwgldepllkhwefd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2icwB (B:)
    gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
    wnsqkdlleqrraavdtycrhnygvgesftvqrrvepkvtvypsktqplqhhnllvcsvs
    gfypgsievrwfrngqeekagvvstgliqngdwtfqtlvmletvprsgevytcqvehpsv
    tspltvewra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2icwB (B:)
    gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
    wnsqkdlleqrraavdtycrhnygvgesftvqrrvepkvtvypsktnllvcsvsgfypgs
    ievrwfrngqeekagvvstgliqngdwtfqtlvmletvprsgevytcqvehpsvtspltv
    ewra
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2icwD (D:)
    eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
    iavdkanleimtkrsnytpitnvppevtvltnspvelrepnvlicfidkftppvvnvtwl
    rngkpvttgvsetvflpredhlfrkfhylpflpstedvydcrvehwgldepllkhwefd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2icwE (E:)
    gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
    wnsqkdlleqrraavdtycrhnygvgesftvqrrvepkvtvypsktqplqhhnllvcsvs
    gfypgsievrwfrngqeekagvvstgliqngdwtfqtlvmletvprsgevytcqvehpsv
    tspltvewra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2icwE (E:)
    gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
    wnsqkdlleqrraavdtycrhnygvgesftvqrrvepkvtvypsktqnllvcsvsgfypg
    sievrwfrngqeekagvvstgliqngdwtfqtlvmletvprsgevytcqvehpsvtsplt
    vewra
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2icwG (G:)
    mklrvenpkkaqkhfvqnlnnvvftnkelediynlsnkeetkevlklfklkvnqfyrhaf
    givndynglleykeifnmmflklsvvfdtqrkeannveqikrniaildeimakadndlsy
    fisqnknfqelwdkavkltkemkiklkgqkldlrdgevainkvrelfgsdknvkelwwfr
    sllvkgvylikryyegdielkttsdfakavfed
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2icwH (H:)
    mklrvenpkkaqkhfvqnlnnvvftnkelediynlsnkeetkevlklfklkvnqfyrhaf
    givndynglleykeifnmmflklsvvfdtqrkeannveqikrniaildeimakadndlsy
    fisqnknfqelwdkavkltkemkiklkgqkldlrdgevainkvrelfgsdknvkelwwfr
    sllvkgvylikryyegdielkttsdfakavfed
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2icwJ (J:)
    eaavtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghelrlihysygagstekgdi
    pdgykasrpsqenfslilesatpsqtsvyfcasggggtlyfgagtrlsvlssa
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2icwL (L:)
    eaavtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghelrlihysygagstekgdi
    pdgykasrpsqenfslilesatpsqtsvyfcasggggtlyfgagtrlsvlssa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2icwL (L:)
    avtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghelrlihysygagstekgdipd
    gykasrpsqenfslilesatpsqtsvyfcasggggtlyfgagtrlsvlssa