Lineage for d2i26p2 (2i26 P:2-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2745421Species Nurse shark (Ginglymostoma cirratum) [TaxId:7801] [187220] (4 PDB entries)
  8. 2745428Domain d2i26p2: 2i26 P:2-112 [145419]
    Other proteins in same PDB: d2i26l_, d2i26m_, d2i26n1, d2i26n2, d2i26o3, d2i26p3, d2i26q_
    automated match to d2i26o_
    complexed with so4

Details for d2i26p2

PDB Entry: 2i26 (more details), 2.5 Å

PDB Description: Crystal structure analysis of the nurse shark new antigen receptor ancestral variable domain in complex with lysozyme
PDB Compounds: (P:) New Antigen Receptor Ancestral

SCOPe Domain Sequences for d2i26p2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i26p2 b.1.1.1 (P:2-112) automated matches {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]}
rvdqtpqtitketgesltincvlrdsncalsstywyrkksgstneesiskggryvetvns
gsksfslrindltvedsgtyrckpesrygsydaecaalndqygggtvvtvn

SCOPe Domain Coordinates for d2i26p2:

Click to download the PDB-style file with coordinates for d2i26p2.
(The format of our PDB-style files is described here.)

Timeline for d2i26p2: