Class a: All alpha proteins [46456] (286 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H2A [47115] (6 species) |
Species Mouse (Mus musculus), H2A.1 [TaxId:10090] [158384] (1 PDB entry) Uniprot P22752 14-118 |
Domain d2f8nk1: 2f8n K:14-118 [145150] Other proteins in same PDB: d2f8na_, d2f8nb_, d2f8nd_, d2f8ne_, d2f8nf_, d2f8ng_, d2f8nh_ protein/DNA complex |
PDB Entry: 2f8n (more details), 2.9 Å
SCOPe Domain Sequences for d2f8nk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f8nk1 a.22.1.1 (K:14-118) Histone H2A {Mouse (Mus musculus), H2A.1 [TaxId: 10090]} aktrssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagnaardn kktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpk
Timeline for d2f8nk1: