Lineage for d2f8nk1 (2f8n K:14-118)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987252Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1987253Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1987254Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1987255Protein Histone H2A [47115] (6 species)
  7. 1987348Species Mouse (Mus musculus), H2A.1 [TaxId:10090] [158384] (1 PDB entry)
    Uniprot P22752 14-118
  8. 1987349Domain d2f8nk1: 2f8n K:14-118 [145150]
    Other proteins in same PDB: d2f8na_, d2f8nb_, d2f8nd_, d2f8ne_, d2f8nf_, d2f8ng_, d2f8nh_
    protein/DNA complex

Details for d2f8nk1

PDB Entry: 2f8n (more details), 2.9 Å

PDB Description: 2.9 Angstrom X-ray structure of hybrid macroH2A nucleosomes
PDB Compounds: (K:) Histone H2A type 1

SCOPe Domain Sequences for d2f8nk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f8nk1 a.22.1.1 (K:14-118) Histone H2A {Mouse (Mus musculus), H2A.1 [TaxId: 10090]}
aktrssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagnaardn
kktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpk

SCOPe Domain Coordinates for d2f8nk1:

Click to download the PDB-style file with coordinates for d2f8nk1.
(The format of our PDB-style files is described here.)

Timeline for d2f8nk1: