Class a: All alpha proteins [46456] (286 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein macro-H2A.1, histone domain [140396] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [140397] (2 PDB entries) Uniprot O75367 11-116 |
Domain d2f8ng_: 2f8n G: [133138] Other proteins in same PDB: d2f8na_, d2f8nb_, d2f8nd_, d2f8ne_, d2f8nf_, d2f8nh_, d2f8nk1 automated match to d1u35c1 protein/DNA complex |
PDB Entry: 2f8n (more details), 2.9 Å
SCOPe Domain Sequences for d2f8ng_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f8ng_ a.22.1.1 (G:) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} stktsrsakagvifpvgrmlryikkghpkyrigvgapvymaavleyltaeilelavnaar dnkkgrvtprhillavandeelnqllkgvtiasggvlpnihpellakk
Timeline for d2f8ng_: