Lineage for d2axte1 (2axt E:3-84)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887128Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 887780Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. 887781Family f.23.38.1: Cytochrome b559 subunits [161046] (2 proteins)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. 887782Protein Cytochrome b559 subunit alpha, PsbE [161047] (1 species)
  7. 887783Species Thermosynechococcus elongatus [TaxId:146786] [161048] (1 PDB entry)
    Uniprot Q8DIP0 3-84
  8. 887784Domain d2axte1: 2axt E:3-84 [144930]
    Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv1, d2axtz1
    complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd

Details for d2axte1

PDB Entry: 2axt (more details), 3 Å

PDB Description: crystal structure of photosystem ii from thermosynechococcus elongatus
PDB Compounds: (E:) cytochrome b559 alpha subunit

SCOP Domain Sequences for d2axte1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axte1 f.23.38.1 (E:3-84) Cytochrome b559 subunit alpha, PsbE {Thermosynechococcus elongatus [TaxId: 146786]}
gttgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrs
iplvtdrfeakqqvetfleqlk

SCOP Domain Coordinates for d2axte1:

Click to download the PDB-style file with coordinates for d2axte1.
(The format of our PDB-style files is described here.)

Timeline for d2axte1: