Lineage for d2axte1 (2axt E:3-84)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026744Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. 3026745Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. 3026746Protein Cytochrome b559 subunit alpha, PsbE [161047] (2 species)
  7. 3026747Species Thermosynechococcus elongatus [TaxId:146786] [161048] (7 PDB entries)
    Uniprot Q8DIP0 3-84
  8. 3026754Domain d2axte1: 2axt E:3-84 [144930]
    Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv_, d2axtz1
    complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd, unk
    has additional insertions and/or extensions that are not grouped together

Details for d2axte1

PDB Entry: 2axt (more details), 3 Å

PDB Description: crystal structure of photosystem ii from thermosynechococcus elongatus
PDB Compounds: (E:) cytochrome b559 alpha subunit

SCOPe Domain Sequences for d2axte1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axte1 f.23.38.1 (E:3-84) Cytochrome b559 subunit alpha, PsbE {Thermosynechococcus elongatus [TaxId: 146786]}
gttgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrs
iplvtdrfeakqqvetfleqlk

SCOPe Domain Coordinates for d2axte1:

Click to download the PDB-style file with coordinates for d2axte1.
(The format of our PDB-style files is described here.)

Timeline for d2axte1: