![]() | Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
![]() | Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (1 family) ![]() |
![]() | Family f.23.36.1: PsbK-like [161038] (1 protein) Pfam PF02533 |
![]() | Protein Photosystem II reaction center protein K, PsbK [161039] (1 species) |
![]() | Species Thermosynechococcus elongatus [TaxId:146786] [161040] (1 PDB entry) Uniprot Q9F1K9 10-46 |
![]() | Domain d2axtk1: 2axt K:10-46 [144935] Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv1, d2axtz1 complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd |
PDB Entry: 2axt (more details), 3 Å
SCOP Domain Sequences for d2axtk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2axtk1 f.23.36.1 (K:10-46) Photosystem II reaction center protein K, PsbK {Thermosynechococcus elongatus [TaxId: 146786]} klpeayaifdplvdvlpvipvlflalafvwqaavgfr
Timeline for d2axtk1: