Lineage for d2axtj1 (2axt J:7-40)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887128Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 887750Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (1 family) (S)
  5. 887751Family f.23.32.1: PsbJ-like [161022] (1 protein)
    Pfam PF01788
  6. 887752Protein Photosystem II reaction center protein J, PsbJ [161023] (1 species)
  7. 887753Species Thermosynechococcus elongatus [TaxId:146786] [161024] (1 PDB entry)
    Uniprot P59087 7-40
  8. 887754Domain d2axtj1: 2axt J:7-40 [144934]
    Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv1, d2axtz1
    complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd

Details for d2axtj1

PDB Entry: 2axt (more details), 3 Å

PDB Description: crystal structure of photosystem ii from thermosynechococcus elongatus
PDB Compounds: (J:) Photosystem II reaction center J protein

SCOP Domain Sequences for d2axtj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axtj1 f.23.32.1 (J:7-40) Photosystem II reaction center protein J, PsbJ {Thermosynechococcus elongatus [TaxId: 146786]}
riplwivatvagmgvivivglffygayaglgssl

SCOP Domain Coordinates for d2axtj1:

Click to download the PDB-style file with coordinates for d2axtj1.
(The format of our PDB-style files is described here.)

Timeline for d2axtj1: