![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.12: PsbU/PolX domain-like [81585] (2 families) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.12.2: PsbU-like [158539] (1 protein) Pfam PF06514 |
![]() | Protein Photosystem II 12 kDa extrinsic protein PsbU [158540] (1 species) |
![]() | Species Thermosynechococcus elongatus [TaxId:146786] [158541] (1 PDB entry) Uniprot Q9F1L5 37-134 |
![]() | Domain d2axtu1: 2axt U:37-134 [144940] Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtv1, d2axtz1 complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd |
PDB Entry: 2axt (more details), 3 Å
SCOP Domain Sequences for d2axtu1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2axtu1 a.60.12.2 (U:37-134) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus elongatus [TaxId: 146786]} eelvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipg lterqkqilrenlehftvtevetalveggdrynnglyk
Timeline for d2axtu1: