Class g: Small proteins [56992] (100 folds) |
Fold g.30: Carboxypeptidase inhibitor [57619] (1 superfamily) disulfide-rich, alpha+beta |
Superfamily g.30.1: Carboxypeptidase inhibitor [57620] (1 family) |
Family g.30.1.1: Carboxypeptidase inhibitor [57621] (2 proteins) |
Protein automated matches [190471] (1 species) not a true protein |
Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [187391] (1 PDB entry) |
Domain d2abzf_: 2abz F: [144800] Other proteins in same PDB: d2abza_, d2abzb_, d2abzc1 automated match to d1dtva_ complexed with zn; mutant |
PDB Entry: 2abz (more details), 2.16 Å
SCOPe Domain Sequences for d2abzf_:
Sequence, based on SEQRES records: (download)
>d2abzf_ g.30.1.1 (F:) automated matches {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]} tpdesflcyqpdqvcaficrgaaplpsegecnphptapwaregavewvpystgqcrttci pyv
>d2abzf_ g.30.1.1 (F:) automated matches {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]} tpdesflcyqpdqvcaficrgaaplpsegecnphptapwarvewvptgqcrttcipyv
Timeline for d2abzf_: