Lineage for d1dtva_ (1dtv A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034964Fold g.30: Carboxypeptidase inhibitor [57619] (1 superfamily)
    disulfide-rich, alpha+beta
  4. 3034965Superfamily g.30.1: Carboxypeptidase inhibitor [57620] (1 family) (S)
  5. 3034966Family g.30.1.1: Carboxypeptidase inhibitor [57621] (2 proteins)
  6. 3034967Protein Carboxypeptidase inhibitor [57622] (1 species)
  7. 3034968Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [57623] (5 PDB entries)
  8. 3034971Domain d1dtva_: 1dtv A: [44963]

Details for d1dtva_

PDB Entry: 1dtv (more details)

PDB Description: nmr structure of the leech carboxypeptidase inhibitor (lci)
PDB Compounds: (A:) carboxypeptidase inhibitor

SCOPe Domain Sequences for d1dtva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dtva_ g.30.1.1 (A:) Carboxypeptidase inhibitor {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
gshtpdesflcyqpdqvccficrgaaplpsegecnphptapwcregavewvpystgqcrt
tcipyve

SCOPe Domain Coordinates for d1dtva_:

Click to download the PDB-style file with coordinates for d1dtva_.
(The format of our PDB-style files is described here.)

Timeline for d1dtva_: