Lineage for d2abze_ (2abz E:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034964Fold g.30: Carboxypeptidase inhibitor [57619] (1 superfamily)
    disulfide-rich, alpha+beta
  4. 3034965Superfamily g.30.1: Carboxypeptidase inhibitor [57620] (1 family) (S)
  5. 3034966Family g.30.1.1: Carboxypeptidase inhibitor [57621] (2 proteins)
  6. 3034974Protein automated matches [190471] (1 species)
    not a true protein
  7. 3034975Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [187391] (1 PDB entry)
  8. 3034977Domain d2abze_: 2abz E: [144799]
    Other proteins in same PDB: d2abza_, d2abzb_, d2abzc1
    automated match to d1dtva_
    complexed with zn; mutant

Details for d2abze_

PDB Entry: 2abz (more details), 2.16 Å

PDB Description: crystal structure of c19a/c43a mutant of leech carboxypeptidase inhibitor in complex with bovine carboxypeptidase a
PDB Compounds: (E:) Metallocarboxypeptidase inhibitor

SCOPe Domain Sequences for d2abze_:

Sequence, based on SEQRES records: (download)

>d2abze_ g.30.1.1 (E:) automated matches {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
desflcyqpdqvcaficrgaaplpsegecnphptapwaregavewvpystgqcrttcipy
v

Sequence, based on observed residues (ATOM records): (download)

>d2abze_ g.30.1.1 (E:) automated matches {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
desflcyqpdqvcaficrgaaplpsegecnphptapwaregavewvpytgqcrttcipyv

SCOPe Domain Coordinates for d2abze_:

Click to download the PDB-style file with coordinates for d2abze_.
(The format of our PDB-style files is described here.)

Timeline for d2abze_: