Lineage for d1tu2b1 (1tu2 B:1-169,B:236-254)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2768468Superfamily b.2.6: Cytochrome f, large domain [49441] (1 family) (S)
  5. 2768469Family b.2.6.1: Cytochrome f, large domain [49442] (1 protein)
  6. 2768470Protein Cytochrome f, large domain [49443] (5 species)
    this domain is interrupted by a small domain which is barrel-sandwich hybrid fold
  7. 2768491Species Nostoc sp. PCC 7120 [TaxId:103690] [158930] (1 PDB entry)
    Uniprot Q93SW9 45-213,280-298
  8. 2768492Domain d1tu2b1: 1tu2 B:1-169,B:236-254 [144380]
    Other proteins in same PDB: d1tu2a1, d1tu2b2
    complexed with cu, hec

Details for d1tu2b1

PDB Entry: 1tu2 (more details)

PDB Description: the complex of nostoc cytochrome f and plastocyanin determin with paramagnetic nmr. based on the structures of cytochrome f and plastocyanin, 10 structures
PDB Compounds: (B:) Apocytochrome f

SCOPe Domain Sequences for d1tu2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tu2b1 b.2.6.1 (B:1-169,B:236-254) Cytochrome f, large domain {Nostoc sp. PCC 7120 [TaxId: 103690]}
ypfwaqqtypetpreptgrivcanchlaakptevevpqsvlpdtvfkavvkipydtsvqq
vgadgskvglnvgavlmlpegfkiapedripeelkeeigdvyfqpygedkdnivivgplp
geqyqeivfpvlspnpandknihfgkysvhvggnrgrgqvyptgeksnnXnvggfgqlda
eivlqdanr

SCOPe Domain Coordinates for d1tu2b1:

Click to download the PDB-style file with coordinates for d1tu2b1.
(The format of our PDB-style files is described here.)

Timeline for d1tu2b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tu2b2
View in 3D
Domains from other chains:
(mouse over for more information)
d1tu2a1