Class b: All beta proteins [48724] (174 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.6: Cytochrome f, large domain [49441] (1 family) |
Family b.2.6.1: Cytochrome f, large domain [49442] (1 protein) |
Protein Cytochrome f, large domain [49443] (5 species) this domain is interrupted by a small domain which is barrel-sandwich hybrid fold |
Species Anabaena sp., PCC 7120 [TaxId:103690] [158930] (1 PDB entry) Uniprot Q93SW9 45-213,280-298 |
Domain d1tu2b1: 1tu2 B:1-169,B:236-254 [144380] Other proteins in same PDB: d1tu2a1, d1tu2b2 complexed with cu, hec |
PDB Entry: 1tu2 (more details)
SCOP Domain Sequences for d1tu2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tu2b1 b.2.6.1 (B:1-169,B:236-254) Cytochrome f, large domain {Anabaena sp., PCC 7120 [TaxId: 1167]} ypfwaqqtypetpreptgrivcanchlaakptevevpqsvlpdtvfkavvkipydtsvqq vgadgskvglnvgavlmlpegfkiapedripeelkeeigdvyfqpygedkdnivivgplp geqyqeivfpvlspnpandknihfgkysvhvggnrgrgqvyptgeksnnXnvggfgqlda eivlqdanr
Timeline for d1tu2b1: