Lineage for d2uxcc1 (2uxc C:2-106)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722707Fold d.52: Alpha-lytic protease prodomain-like [54805] (8 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 722734Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 722735Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)
  6. 722748Protein Ribosomal protein S3 N-terminal domain [54816] (2 species)
  7. 722751Species Thermus thermophilus [TaxId:274] [54817] (36 PDB entries)
  8. 722765Domain d2uxcc1: 2uxc C:2-106 [140004]
    Other proteins in same PDB: d2uxcb1, d2uxcc2, d2uxcd1, d2uxce1, d2uxce2, d2uxcf1, d2uxcg1, d2uxch1, d2uxci1, d2uxcj1, d2uxck1, d2uxcl1, d2uxcm1, d2uxcn1, d2uxco1, d2uxcp1, d2uxcq1, d2uxcr1, d2uxcs1, d2uxct1
    automatically matched to d1fjgc1
    complexed with k, mg, par, zn

Details for d2uxcc1

PDB Entry: 2uxc (more details), 2.9 Å

PDB Description: crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
PDB Compounds: (C:) ribosomal protein s3

SCOP Domain Sequences for d2uxcc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxcc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus [TaxId: 274]}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev

SCOP Domain Coordinates for d2uxcc1:

Click to download the PDB-style file with coordinates for d2uxcc1.
(The format of our PDB-style files is described here.)

Timeline for d2uxcc1: