SCOPe 2.08: Domain d2uxcc1: 2uxc C:2-106

Lineage for d2uxcc1 (2uxc C:2-106)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (2 families)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)

6. Protein Ribosomal protein S3 N-terminal domain [54816] (4 species)

7. Species Thermus thermophilus [TaxId:274] [54817] (36 PDB entries)
   Uniprot P80372

8. Domain d2uxcc1: 2uxc C:2-106 [140004]
   Other proteins in same PDB: d2uxcb1, d2uxcc2, d2uxcd1, d2uxce1, d2uxce2, d2uxcf1, d2uxcg1, d2uxch1, d2uxci1, d2uxcj1, d2uxck1, d2uxcl1, d2uxcm1, d2uxcn1, d2uxco1, d2uxcp1, d2uxcq1, d2uxcr1, d2uxcs1, d2uxct1, d2uxcu1
   automatically matched to d1fjgc1
   protein/RNA complex; complexed with k, mg, par, zn

Details for d2uxcc1

PDB Entry: 2uxc, 2.9 Å

PDB Description: crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.

PDB Compounds: (C:) ribosomal protein s3

SCOPe Domain Sequences for d2uxcc1:

Sequence; same for both SEQRES and ATOM records:

>d2uxcc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus [TaxId: 274]}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev

Timeline for d2uxcc1:

• d2uxcc1 first appeared in SCOP 1.73
  
• d2uxcc1 appears in SCOPe 2.07