Lineage for d2uxcs1 (2uxc S:2-81)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720813Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
    alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123
  4. 720814Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
  5. 720815Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 720816Protein Ribosomal protein S19 [54572] (1 species)
  7. 720817Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries)
  8. 720831Domain d2uxcs1: 2uxc S:2-81 [140022]
    Other proteins in same PDB: d2uxcb1, d2uxcc1, d2uxcc2, d2uxcd1, d2uxce1, d2uxce2, d2uxcf1, d2uxcg1, d2uxch1, d2uxci1, d2uxcj1, d2uxck1, d2uxcl1, d2uxcm1, d2uxcn1, d2uxco1, d2uxcp1, d2uxcq1, d2uxcr1, d2uxct1
    automatically matched to d1fjgs_
    complexed with k, mg, par, zn

Details for d2uxcs1

PDB Entry: 2uxc (more details), 2.9 Å

PDB Description: crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
PDB Compounds: (S:) ribosomal protein s19

SCOP Domain Sequences for d2uxcs1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxcs1 d.28.1.1 (S:2-81) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

SCOP Domain Coordinates for d2uxcs1:

Click to download the PDB-style file with coordinates for d2uxcs1.
(The format of our PDB-style files is described here.)

Timeline for d2uxcs1: