Lineage for d2uxcr1 (2uxc R:19-88)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 636073Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 636074Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 636075Protein Ribosomal protein S18 [46913] (1 species)
  7. 636076Species Thermus thermophilus [TaxId:274] [46914] (38 PDB entries)
  8. 636090Domain d2uxcr1: 2uxc R:19-88 [140021]
    Other proteins in same PDB: d2uxcb1, d2uxcc1, d2uxcc2, d2uxcd1, d2uxce1, d2uxce2, d2uxcf1, d2uxcg1, d2uxch1, d2uxci1, d2uxcj1, d2uxck1, d2uxcl1, d2uxcm1, d2uxcn1, d2uxco1, d2uxcp1, d2uxcq1, d2uxcs1, d2uxct1
    automatically matched to 2J00 R:19-88
    complexed with k, mg, par, zn

Details for d2uxcr1

PDB Entry: 2uxc (more details), 2.9 Å

PDB Description: crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
PDB Compounds: (R:) ribosomal protein s18

SCOP Domain Sequences for d2uxcr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxcr1 a.4.8.1 (R:19-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
kakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsakeqrilaktikrarilgl
lpfteklvrk

SCOP Domain Coordinates for d2uxcr1:

Click to download the PDB-style file with coordinates for d2uxcr1.
(The format of our PDB-style files is described here.)

Timeline for d2uxcr1: