Lineage for d2uube2 (2uub E:5-73)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2553728Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2553729Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 2553810Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)
    automatically mapped to Pfam PF00333
  6. 2553811Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species)
    lacks the N-terminal helix
  7. 2553839Species Thermus thermophilus [TaxId:274] [54781] (36 PDB entries)
    Uniprot P27152
  8. 2553847Domain d2uube2: 2uub E:5-73 [139937]
    Other proteins in same PDB: d2uubb1, d2uubc1, d2uubc2, d2uubd1, d2uube1, d2uubf1, d2uubg1, d2uubh1, d2uubj1, d2uubk1, d2uubl1, d2uubm1, d2uubn1, d2uubo1, d2uubp1, d2uubq1, d2uubr1, d2uubs1, d2uubt1, d2uubu1
    automatically matched to d1i94e2
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uube2

PDB Entry: 2uub (more details), 2.8 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d2uube2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uube2 d.50.1.2 (E:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus [TaxId: 274]}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqn

SCOPe Domain Coordinates for d2uube2:

Click to download the PDB-style file with coordinates for d2uube2.
(The format of our PDB-style files is described here.)

Timeline for d2uube2: