| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) ![]() |
| Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein) |
| Protein Ribosomal protein S6 [54997] (4 species) |
| Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries) Uniprot P23370 |
| Domain d2uubf1: 2uub F:1-101 [139938] Other proteins in same PDB: d2uubb1, d2uubc1, d2uubc2, d2uubd1, d2uube1, d2uube2, d2uubg1, d2uubh1, d2uubj1, d2uubk1, d2uubl1, d2uubm1, d2uubn1, d2uubo1, d2uubp1, d2uubq1, d2uubr1, d2uubs1, d2uubt1, d2uubu1 automatically matched to d1fjgf_ protein/RNA complex; complexed with k, mg, par, zn |
PDB Entry: 2uub (more details), 2.8 Å
SCOPe Domain Sequences for d2uubf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uubf1 d.58.14.1 (F:1-101) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana
Timeline for d2uubf1: