![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
![]() | Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) ![]() |
![]() | Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein) contains additional N-terminal helix that forms a separate unit automatically mapped to Pfam PF00312 |
![]() | Protein Ribosomal protein S15 [47065] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries) Uniprot P80378 |
![]() | Domain d2uubo1: 2uub O:2-89 [139946] Other proteins in same PDB: d2uubb1, d2uubc1, d2uubc2, d2uubd1, d2uube1, d2uube2, d2uubf1, d2uubg1, d2uubh1, d2uubj1, d2uubk1, d2uubl1, d2uubm1, d2uubn1, d2uubp1, d2uubq1, d2uubr1, d2uubs1, d2uubt1, d2uubu1 automatically matched to d1ab3__ protein/RNA complex; complexed with k, mg, par, zn |
PDB Entry: 2uub (more details), 2.8 Å
SCOPe Domain Sequences for d2uubo1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uubo1 a.16.1.2 (O:2-89) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]} pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg qrrrllrylqredperyralieklgirg
Timeline for d2uubo1: