| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.50: dsRBD-like [54767] (5 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) ![]() |
| Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein) |
| Protein Ribosomal S5 protein, N-terminal domain [54779] (2 species) lacks the N-terminal helix |
| Species Thermus thermophilus [TaxId:274] [54781] (36 PDB entries) |
| Domain d2uube2: 2uub E:5-73 [139937] Other proteins in same PDB: d2uubb1, d2uubc1, d2uubc2, d2uubd1, d2uube1, d2uubf1, d2uubg1, d2uubh1, d2uubj1, d2uubk1, d2uubl1, d2uubm1, d2uubn1, d2uubo1, d2uubp1, d2uubq1, d2uubr1, d2uubs1, d2uubt1 automatically matched to d1i94e2 complexed with 6mz, cm0, k, mg, par, zn |
PDB Entry: 2uub (more details), 2.8 Å
SCOP Domain Sequences for d2uube2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uube2 d.50.1.2 (E:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus [TaxId: 274]}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqn
Timeline for d2uube2: