Lineage for d2pwze1 (2pwz E:1-145)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 977429Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)
  6. 977566Protein Malate dehydrogenase [51849] (12 species)
  7. 977601Species Escherichia coli [TaxId:562] [51853] (5 PDB entries)
  8. 977610Domain d2pwze1: 2pwz E:1-145 [139770]
    Other proteins in same PDB: d2pwza2, d2pwzc2, d2pwze2, d2pwzg2
    automatically matched to d1emd_1

Details for d2pwze1

PDB Entry: 2pwz (more details), 2.2 Å

PDB Description: crystal structure of the apo form of e.coli malate dehydrogenase
PDB Compounds: (E:) malate dehydrogenase

SCOPe Domain Sequences for d2pwze1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pwze1 c.2.1.5 (E:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]}
mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
edatpalegadvvlisagvarkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp
vnttvaiaaevlkkagvydknklfg

SCOPe Domain Coordinates for d2pwze1:

Click to download the PDB-style file with coordinates for d2pwze1.
(The format of our PDB-style files is described here.)

Timeline for d2pwze1: