SCOPe 2.02: Domain d2pwze1: 2pwz E:1-145

Lineage for d2pwze1 (2pwz E:1-145)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)

6. Protein Malate dehydrogenase [51849] (12 species)

7. Species Escherichia coli [TaxId:562] [51853] (5 PDB entries)

8. Domain d2pwze1: 2pwz E:1-145 [139770]
   Other proteins in same PDB: d2pwza2, d2pwzc2, d2pwze2, d2pwzg2
   automatically matched to d1emd_1

Details for d2pwze1

PDB Entry: 2pwz, 2.2 Å

PDB Description: crystal structure of the apo form of e.coli malate dehydrogenase

PDB Compounds: (E:) malate dehydrogenase

SCOPe Domain Sequences for d2pwze1:

Sequence; same for both SEQRES and ATOM records:

>d2pwze1 c.2.1.5 (E:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]}
mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
edatpalegadvvlisagvarkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp
vnttvaiaaevlkkagvydknklfg

Timeline for d2pwze1:

• d2pwze1 first appeared in SCOP 1.73
  
• d2pwze1 appears in SCOPe 2.01
  
• d2pwze1 appears in SCOPe 2.03
  
• d2pwze1 appears in the current release, SCOPe 2.08