Lineage for d2pwzc2 (2pwz C:146-312)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1047016Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1047017Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 1047018Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
  6. 1047126Protein Malate dehydrogenase [56329] (11 species)
  7. 1047158Species Escherichia coli [TaxId:562] [56333] (5 PDB entries)
  8. 1047166Domain d2pwzc2: 2pwz C:146-312 [139769]
    Other proteins in same PDB: d2pwza1, d2pwzc1, d2pwze1, d2pwzg1
    automatically matched to d1emd_2

Details for d2pwzc2

PDB Entry: 2pwz (more details), 2.2 Å

PDB Description: crystal structure of the apo form of e.coli malate dehydrogenase
PDB Compounds: (C:) malate dehydrogenase

SCOPe Domain Sequences for d2pwzc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pwzc2 d.162.1.1 (C:146-312) Malate dehydrogenase {Escherichia coli [TaxId: 562]}
vttldiirsntfvaelkgkqpgevevpvigghsgvtilpllsqvpgvsfteqevadltkr
iqnagtevveakagggsatlsmgqaaarfglslvralqgeqgvvecayvegdgqyarffs
qplllgkngveerksigtlsafeqnalegmldtlkkdialgeefvnk

SCOPe Domain Coordinates for d2pwzc2:

Click to download the PDB-style file with coordinates for d2pwzc2.
(The format of our PDB-style files is described here.)

Timeline for d2pwzc2: