SCOP 1.73: Domain d2otja2: 2otj A:1-90

Lineage for d2otja2 (2otj A:1-90)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.40: OB-fold [50198] (12 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins)
   barrel, closed; n=5, S=8

6. Protein N-terminal domain of ribosomal protein L2 [50299] (2 species)
   incomplete OB-fold lacking the last strand

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [50301] (40 PDB entries)
   includes the N-terminal tail

8. Domain d2otja2: 2otj A:1-90 [139317]
   Other proteins in same PDB: d2otj11, d2otj31, d2otja1, d2otjb1, d2otjc1, d2otjd1, d2otje1, d2otje2, d2otjf1, d2otjh1, d2otji1, d2otjj1, d2otjk1, d2otjl1, d2otjm1, d2otjn1, d2otjo1, d2otjp1, d2otjq1, d2otjr1, d2otjs1, d2otjt1, d2otju1, d2otjv1, d2otjw1, d2otjx1, d2otjy1, d2otjz1
   automatically matched to d1s72a2
   complexed with 13t, 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3

Details for d2otja2

PDB Entry: 2otj, 2.9 Å

PDB Description: 13-deoxytedanolide bound to the large subunit of haloarcula marismortui

PDB Compounds: (A:) 50S ribosomal protein L2P

SCOP Domain Sequences for d2otja2:

Sequence; same for both SEQRES and ATOM records:

>d2otja2 b.40.4.5 (A:1-90) N-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui [TaxId: 2238]}
grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
edgdrrlilapegvgvgdelqvgvsaeiap

Timeline for d2otja2:

• d2otja2 is new in SCOP 1.73
  
• d2otja2 appears in SCOP 1.75
  
• d2otja2 appears in the current release, SCOPe 2.08