![]() | Class g: Small proteins [56992] (85 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (16 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (6 families) ![]() |
![]() | Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein) |
![]() | Protein Ribosomal protein L44e [57837] (1 species) |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [57838] (40 PDB entries) |
![]() | Domain d2otj31: 2otj 3:1-92 [139315] Other proteins in same PDB: d2otj11, d2otja1, d2otja2, d2otjb1, d2otjc1, d2otjd1, d2otje1, d2otje2, d2otjf1, d2otjh1, d2otji1, d2otjj1, d2otjk1, d2otjl1, d2otjm1, d2otjn1, d2otjo1, d2otjp1, d2otjq1, d2otjr1, d2otjs1, d2otjt1, d2otju1, d2otjv1, d2otjw1, d2otjx1, d2otjy1, d2otjz1 automatically matched to d1ffkz_ complexed with 13t, 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3 |
PDB Entry: 2otj (more details), 2.9 Å
SCOP Domain Sequences for d2otj31:
Sequence; same for both SEQRES and ATOM records: (download)
>d2otj31 g.41.8.3 (3:1-92) Ribosomal protein L44e {Archaeon Haloarcula marismortui [TaxId: 2238]} mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk ptkktdlkyrcgecgkahlregwragrlefqe
Timeline for d2otj31:
![]() Domains from other chains: (mouse over for more information) d2otj11, d2otja1, d2otja2, d2otjb1, d2otjc1, d2otjd1, d2otje1, d2otje2, d2otjf1, d2otjh1, d2otji1, d2otjj1, d2otjk1, d2otjl1, d2otjm1, d2otjn1, d2otjo1, d2otjp1, d2otjq1, d2otjr1, d2otjs1, d2otjt1, d2otju1, d2otjv1, d2otjw1, d2otjx1, d2otjy1, d2otjz1 |