SCOP 1.73: Domain d2otjz1: 2otj Z:10-82

Lineage for d2otjz1 (2otj Z:10-82)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (6 families)

5. Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)

6. Protein Ribosomal protein L37ae [57831] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [57832] (40 PDB entries)

8. Domain d2otjz1: 2otj Z:10-82 [139342]
   Other proteins in same PDB: d2otj11, d2otj31, d2otja1, d2otja2, d2otjb1, d2otjc1, d2otjd1, d2otje1, d2otje2, d2otjf1, d2otjh1, d2otji1, d2otjj1, d2otjk1, d2otjl1, d2otjm1, d2otjn1, d2otjo1, d2otjp1, d2otjq1, d2otjr1, d2otjs1, d2otjt1, d2otju1, d2otjv1, d2otjw1, d2otjx1, d2otjy1
   automatically matched to d1s72z_
   complexed with 13t, 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3

Details for d2otjz1

PDB Entry: 2otj, 2.9 Å

PDB Description: 13-deoxytedanolide bound to the large subunit of haloarcula marismortui

PDB Compounds: (Z:) 50S ribosomal protein L37Ae

SCOP Domain Sequences for d2otjz1:

Sequence; same for both SEQRES and ATOM records:

>d2otjz1 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]}
rsgrfgarygrvsrrrvaeiesemnedhacpncgedrvdrqgtgiwqcsycdykftggsy
kpetpggktvrrs

Timeline for d2otjz1:

• d2otjz1 is new in SCOP 1.73
  
• d2otjz1 appears in SCOP 1.75
  
• d2otjz1 appears in the current release, SCOPe 2.08