Lineage for d2otjc1 (2otj C:1-246)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691529Fold c.22: Ribosomal protein L4 [52165] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423
  4. 691530Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) (S)
  5. 691531Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein)
  6. 691532Protein Ribosomal protein L4 [52168] (2 species)
    synonym: 50S ribosomal protein L4e, HMAL4, HL6
  7. 691533Species Archaeon Haloarcula marismortui [TaxId:2238] [52170] (44 PDB entries)
  8. 691555Domain d2otjc1: 2otj C:1-246 [139319]
    Other proteins in same PDB: d2otj11, d2otj31, d2otja1, d2otja2, d2otjb1, d2otjd1, d2otje1, d2otje2, d2otjf1, d2otjh1, d2otji1, d2otjj1, d2otjk1, d2otjl1, d2otjm1, d2otjn1, d2otjo1, d2otjp1, d2otjq1, d2otjr1, d2otjs1, d2otjt1, d2otju1, d2otjv1, d2otjw1, d2otjx1, d2otjy1, d2otjz1
    automatically matched to d1jj2c_
    complexed with 13t, 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3

Details for d2otjc1

PDB Entry: 2otj (more details), 2.9 Å

PDB Description: 13-deoxytedanolide bound to the large subunit of haloarcula marismortui
PDB Compounds: (C:) 50S ribosomal protein L4P

SCOP Domain Sequences for d2otjc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2otjc1 c.22.1.1 (C:1-246) Ribosomal protein L4 {Archaeon Haloarcula marismortui [TaxId: 2238]}
mqatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes
fgsgrgqahvpkldgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad
adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs
argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal
aevaer

SCOP Domain Coordinates for d2otjc1:

Click to download the PDB-style file with coordinates for d2otjc1.
(The format of our PDB-style files is described here.)

Timeline for d2otjc1: