Lineage for d2ji3b1 (2ji3 B:38-126)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764803Superfamily b.1.13: Superoxide reductase-like [49367] (2 families) (S)
  5. 2764804Family b.1.13.1: Superoxide reductase-like [49368] (3 proteins)
    binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins
    automatically mapped to Pfam PF01880
  6. 2764827Protein automated matches [190694] (3 species)
    not a true protein
  7. 2764853Species Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId:887] [255263] (3 PDB entries)
  8. 2764863Domain d2ji3b1: 2ji3 B:38-126 [138349]
    Other proteins in same PDB: d2ji3a2, d2ji3b2, d2ji3c2, d2ji3d2
    automated match to d1vzga1
    complexed with ca, fe, no3, per; mutant

Details for d2ji3b1

PDB Entry: 2ji3 (more details), 1.95 Å

PDB Description: x-ray structure of the iron-peroxide intermediate of superoxide reductase (e114a mutant) from desulfoarculus baarsii
PDB Compounds: (B:) desulfoferrodoxin

SCOPe Domain Sequences for d2ji3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ji3b1 b.1.13.1 (B:38-126) automated matches {Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId: 887]}
sentvdaakekhvpviekidggykvkvgavahpmeekhyiqwielladdkcytqflkpgq
apeavflieaakvvaraycnihghwkaen

SCOPe Domain Coordinates for d2ji3b1:

Click to download the PDB-style file with coordinates for d2ji3b1.
(The format of our PDB-style files is described here.)

Timeline for d2ji3b1: