Lineage for d2ibzd2 (2ibz D:261-306)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745533Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 745838Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (1 family) (S)
  5. 745839Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein)
  6. 745840Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (3 species)
  7. 745841Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81493] (5 PDB entries)
  8. 745843Domain d2ibzd2: 2ibz D:261-306 [137222]
    Other proteins in same PDB: d2ibza1, d2ibza2, d2ibzb1, d2ibzb2, d2ibzc1, d2ibzc2, d2ibzd1, d2ibze1, d2ibze2, d2ibzf1, d2ibzg1, d2ibzh1, d2ibzi1, d2ibzx1, d2ibzy1
    automatically matched to d1kb9d2
    complexed with fes, hem, sma, uq6

Details for d2ibzd2

PDB Entry: 2ibz (more details), 2.3 Å

PDB Description: yeast cytochrome bc1 complex with stigmatellin
PDB Compounds: (D:) Cytochrome c1, heme protein, mitochondrial precursor

SCOP Domain Sequences for d2ibzd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ibzd2 f.23.11.1 (D:261-306) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pehderkrlglktviilsslyllsiwvkkfkwagiktrkfvfnppk

SCOP Domain Coordinates for d2ibzd2:

Click to download the PDB-style file with coordinates for d2ibzd2.
(The format of our PDB-style files is described here.)

Timeline for d2ibzd2: