| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
| Family d.185.1.1: MPP-like [63412] (6 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
| Protein Cytochrome bc1 core subunit 2 [63409] (3 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64305] (5 PDB entries) |
| Domain d2ibzb1: 2ibz B:17-218 [137217] Other proteins in same PDB: d2ibza1, d2ibza2, d2ibzc1, d2ibzc2, d2ibzd1, d2ibzd2, d2ibze1, d2ibze2, d2ibzf1, d2ibzg1, d2ibzh1, d2ibzi1, d2ibzx1, d2ibzy1 automatically matched to d1ezvb1 complexed with fes, hem, sma, uq6 |
PDB Entry: 2ibz (more details), 2.3 Å
SCOP Domain Sequences for d2ibzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ibzb1 d.185.1.1 (B:17-218) Cytochrome bc1 core subunit 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ltvsardaptkistlavkvhggsryatkdgvahllnrfnfqntntrsalklvresellgg
tfkstldreyitlkatflkddlpyyvnaladvlyktafkpheltesvlpaarydyavaeq
cpvksaedqlyaitfrkglgnpllydgvervslqdikdfadkvytkenlevsgenvvead
lkrfvdesllstlpagkslvsk
Timeline for d2ibzb1: