Lineage for d2ibzf1 (2ibz F:3-127)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 746353Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 746354Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) (S)
    location - matrix side of the bc1 complex
  5. 746355Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (1 protein)
    probably important for the complex assembly, caps the matrix face of cytochrome b
  6. 746356Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species)
  7. 746357Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81521] (5 PDB entries)
  8. 746359Domain d2ibzf1: 2ibz F:3-127 [137225]
    Other proteins in same PDB: d2ibza1, d2ibza2, d2ibzb1, d2ibzb2, d2ibzc1, d2ibzc2, d2ibzd1, d2ibzd2, d2ibze1, d2ibze2, d2ibzg1, d2ibzh1, d2ibzi1, d2ibzx1, d2ibzy1
    automatically matched to d1ezvf_
    complexed with fes, hem, sma, uq6

Details for d2ibzf1

PDB Entry: 2ibz (more details), 2.3 Å

PDB Description: yeast cytochrome bc1 complex with stigmatellin
PDB Compounds: (F:) Ubiquinol-cytochrome c reductase complex 14 kDa protein

SCOP Domain Sequences for d2ibzf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ibzf1 f.27.1.1 (F:3-127) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qsftsiarigdyilkspvlsklcvpvanqfinlagykklglkfddliaeenpimqtalrr
lpedesyarayriirahqtelthhllprnewikaqedvpyllpyileaeaaakekdeldn
ievsk

SCOP Domain Coordinates for d2ibzf1:

Click to download the PDB-style file with coordinates for d2ibzf1.
(The format of our PDB-style files is described here.)

Timeline for d2ibzf1: