Lineage for d2ibza2 (2ibz A:240-457)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 739189Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 739190Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 739191Family d.185.1.1: MPP-like [63412] (6 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 739192Protein Cytochrome bc1 core subunit 1 [63408] (3 species)
  7. 739193Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64304] (5 PDB entries)
  8. 739197Domain d2ibza2: 2ibz A:240-457 [137216]
    Other proteins in same PDB: d2ibzb1, d2ibzb2, d2ibzc1, d2ibzc2, d2ibzd1, d2ibzd2, d2ibze1, d2ibze2, d2ibzf1, d2ibzg1, d2ibzh1, d2ibzi1, d2ibzx1, d2ibzy1
    automatically matched to d1kb9a2
    complexed with fes, hem, sma, uq6

Details for d2ibza2

PDB Entry: 2ibz (more details), 2.3 Å

PDB Description: yeast cytochrome bc1 complex with stigmatellin
PDB Compounds: (A:) Ubiquinol-cytochrome-c reductase complex core protein 1

SCOP Domain Sequences for d2ibza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ibza2 d.185.1.1 (A:240-457) Cytochrome bc1 core subunit 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kkaaflgsevrlrddtlpkawislavegepvnspnyfvaklaaqifgsynafepasrlqg
iklldniqeyqlcdnfnhfslsykdsglwgfstatrnvtmiddlihftlkqwnrltisvt
dteveraksllklqlgqlyesgnpvndanllgaevlikgsklslgeafkkidaitvkdvk
awagkrlwdqdiaiagtgqieglldymrirsdmsmmrw

SCOP Domain Coordinates for d2ibza2:

Click to download the PDB-style file with coordinates for d2ibza2.
(The format of our PDB-style files is described here.)

Timeline for d2ibza2: