SCOP 1.75: Domain d2hgpq1: 2hgp Q:2-61

Lineage for d2hgpq1 (2hgp Q:2-61)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (18 families)

5. Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)

6. Protein Ribosomal protein S14 [57753] (2 species)

7. Species Thermus thermophilus [TaxId:274] [57754] (45 PDB entries)
   Uniprot P24320

8. Domain d2hgpq1: 2hgp Q:2-61 [136433]
   Other proteins in same PDB: d2hgpe1, d2hgpf1, d2hgpf2, d2hgpg1, d2hgph1, d2hgph2, d2hgpi1, d2hgpj1, d2hgpk1, d2hgpm1, d2hgpn1, d2hgpo1, d2hgpp1, d2hgpr1, d2hgps1, d2hgpt1, d2hgpu1, d2hgpv1, d2hgpw1, d2hgpx1
   automatically matched to d1fjgn_

Details for d2hgpq1

PDB Entry: 2hgp, 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGP contains 30S ribosomal subunit. The 50S ribosomal subunit can be found in PDB entry 2HGQ.

PDB Compounds: (Q:) 30S ribosomal protein S14

SCOP Domain Sequences for d2hgpq1:

Sequence; same for both SEQRES and ATOM records:

>d2hgpq1 g.39.1.7 (Q:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

Timeline for d2hgpq1:

• d2hgpq1 first appeared in SCOP 1.73
  
• d2hgpq1 appears in SCOPe 2.01
  
• d2hgpq1 appears in the current release, SCOPe 2.08