Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) fold elaborated with additional structures |
Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein) |
Protein Ribosomal protein S2 [52315] (3 species) |
Species Thermus thermophilus [TaxId:274] [52316] (46 PDB entries) Uniprot P80371 |
Domain d2hgpe1: 2hgp E:7-240 [136420] Other proteins in same PDB: d2hgpf1, d2hgpf2, d2hgpg1, d2hgph1, d2hgph2, d2hgpi1, d2hgpj1, d2hgpk1, d2hgpm1, d2hgpn1, d2hgpo1, d2hgpp1, d2hgpq1, d2hgpr1, d2hgps1, d2hgpt1, d2hgpu1, d2hgpv1, d2hgpw1, d2hgpx1 automatically matched to d1i94b_ |
PDB Entry: 2hgp (more details), 5.5 Å
SCOP Domain Sequences for d2hgpe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgpe1 c.23.15.1 (E:7-240) Ribosomal protein S2 {Thermus thermophilus [TaxId: 274]} vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq
Timeline for d2hgpe1: