SCOP 1.75: Domain d2hgph1: 2hgp H:74-154

Lineage for d2hgph1 (2hgp H:74-154)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families)

5. Family d.14.1.1: Translational machinery components [54212] (4 proteins)

6. Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)

7. Species Thermus thermophilus [TaxId:274] [54217] (36 PDB entries)
   Uniprot P27152
   Uniprot P80373
   Uniprot P27152 ! Uniprot P80373

8. Domain d2hgph1: 2hgp H:74-154 [136424]
   Other proteins in same PDB: d2hgpe1, d2hgpf1, d2hgpf2, d2hgpg1, d2hgph2, d2hgpi1, d2hgpj1, d2hgpk1, d2hgpm1, d2hgpn1, d2hgpo1, d2hgpp1, d2hgpq1, d2hgpr1, d2hgps1, d2hgpt1, d2hgpu1, d2hgpv1, d2hgpw1, d2hgpx1
   automatically matched to d1i94e1

Details for d2hgph1

PDB Entry: 2hgp, 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGP contains 30S ribosomal subunit. The 50S ribosomal subunit can be found in PDB entry 2HGQ.

PDB Compounds: (H:) 30S ribosomal protein S5

SCOP Domain Sequences for d2hgph1:

Sequence; same for both SEQRES and ATOM records:

>d2hgph1 d.14.1.1 (H:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus [TaxId: 274]}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkg

Timeline for d2hgph1:

• d2hgph1 first appeared in SCOP 1.73
  
• d2hgph1 appears in SCOPe 2.01
  
• d2hgph1 appears in the current release, SCOPe 2.08